PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G059100.2
Common NamePHAVU_010G059100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TCP
Protein Properties Length: 311aa    MW: 34397.7 Da    PI: 6.7215
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G059100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP115.75.8e-36201262111
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaak 92 
                         +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LG+d++sk+++WL+++ak +i++l++++  ++    ++++++++++ ssg  a 
  Phvul.010G059100.2  20 TGRKDRHSKVYTSKGPRDRRVRLSAHTAIEFYDVQDRLGYDRPSKAVDWLIKKAKSSIDKLAELPPWHP---PTHEEKQNDAAGSSGIVAV 107
                         79**************************************************************44444...3445555555555666666 PP

                 TCP  93 saakskksqksaasalnla 111
                         ++++++++q+s+++  n++
  Phvul.010G059100.2 108 EQQQEHHQQQSESCGYNFQ 126
                         6666666666666666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-3220117IPR005333Transcription factor, TCP
PROSITE profilePS5136932.1122280IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MRSSVGDIVQ VEGGHIVRST GRKDRHSKVY TSKGPRDRRV RLSAHTAIEF YDVQDRLGYD  60
RPSKAVDWLI KKAKSSIDKL AELPPWHPPT HEEKQNDAAG SSGIVAVEQQ QEHHQQQSES  120
CGYNFQLQRQ LGAFISTHVD TDPINFQTNN SSEDLGLSLH CFQDQPGLIH WPSQQGANQA  180
PPSNEHQTLF AGSIPVGFEN HYQRTVTWNN EATTGDHVSR MGFFLNSQTF ISQGSASAYA  240
QSETLQSSFS FPMTSSEHQR PQPVHQPSFF GSRFVSDGLA GFCIPDRIQG VEENNGVASN  300
RPSSSPSSIH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134584.10.0hypothetical protein PHAVU_010G059100g
RefseqXP_007134585.10.0hypothetical protein PHAVU_010G059100g
TrEMBLV7AM490.0V7AM49_PHAVU; Uncharacterized protein
STRINGGLYMA06G43721.11e-174(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.31e-47TCP family protein